Product name TB500 CAS No. 77591-33-4 Other Names Thymosin beta 4 Molecular Formula C212H350N56O78S Molecular weight 3108.28 Grade Standard Medicine Grade

namn:Oxytocin Acetate Cas No: 50-56-6(net), 6233-83-6(acetat) Formel: C43H66N12O12S2 Molecular:1007 Sekvens: CYIQNCPLG Purity:98% Utseende: white powder Source: syntetisk

Produktnamn Oxytocin CAS 24346-32-5 Renhet 99% MF C43H65N11O13S2 MW 1008.17

Product Name Oxytocin Synonyms OXYTOCIN; Pitocin; Ocytocin; Syntocinon CAS NO. 50-56-6 Molecular Formula C43H66N12O12S2 Molecular Weight 1007.193 Renhet 99% Appearance White Powder

namn: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetat) Formel: C151H250N44O44S Molecular:3417 Sekvens: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Utseende: white powder Source: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

produktnamn:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molekylär formel: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance: White powder Specification:2mg/vial Grade:Farmaceutisk kvalitet

Product Name Hexarelin Acetate Alias Examorelin CAS 208251-52-9 Molecular Formula C49H62N12O8 Molecular Weight 947.11 Renhet 98% Specification 2mg/vial Grade Pharmaceutical Grade Appearance White Powder

Product name Hexarelin CAS No. 140703-51-1 Other Names Hexarelin Acetate Molecular Formula C47H58N12O6 Molecular weight 3108.28 Grade Standard Medicine Grade

Product Name Ipamorelin Synonyms IpoMarelin;Ipamorelin Acetate;Aib-His-D-2-Nal-D-Phe-Lys-NH2;170851-70-4 CAS 170851-70-4 MF C38H49N9O5 MW 711.863 EINECS N/A Product Categories Peptides Appearance White Lyophilized Powder Purity 99%

produktnamn: Tillväxthormonfrisättande peptid GHRP-6 CAS-nr: 87616-84-0 Molekylär formel: C46H56N12O6 Molekylvikt: 873.01 Härstamning: Kina typ: HGH

Product name GHRP-2 CAS No. 158861-67-7 Other Names Pralmorelin Molecular Formula C45H55N9O6 Molecular weight 817.97 Grade Standard Medicine Grade

Melanotan 2 (MT2)Melanotan-II Melanotan 2CAS 121062-08-6 Melanotan 2Purity (genom HPLC): 99.00% Melanotan 2Appearance: White Powder Melanotan 2CAS Number: 121062-08-6 Melanotan 2Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2 Melanotan 2Molecular Formula: C50H69N15O9 Melanotan 2Molecular weight: 1024.2 Storage Condition; away from light, cold storage (2-8 degree) Användande: prevention sunlight-induce skin cancer; Sexual Dysfunction & Fat Decomposition

Utseende : White powder Specific Optical Rotation (c=0.5,10% HAc) :-50.0~-60.0° Water Content(Karl Fischer) : ≤5.0% Acetate Content(genom HPLC) : ≤15.0% Amino Acid Composition :±10% of theoretical Purity(genom HPLC) : ≥98.0% Single Impurity(genom HPLC) : ≤1.0% Peptide Content(av %N) : ≥80% Assay(Av Vattenfri, Ättiksyrafri ) : 95.0~105.0% Bacterial Endotoxins : ≤5EU/mg

Name PEG MGF CAS No. N/A Synonyms Pegylated MGF, PEG Assay >98% Description White powder Molecular Formula C121H200N42O39 Molar Mass 2888.16 Usage Muscles grow Storage 2-8 degree centigrade refrigerator Specification 2mg/vial Packaging 10 Flaskor/kit

namn: MGF English synonym: Mechano Growth Factor CAS number: 12020-86-9 Molekylär formel: FKLiMgO5Si2+ Molecular weight: 225.51 EINECS-nummer: 200-001-8

namn: Chorionic Gonadotropin English synonym: Peptide HCG CAS number: 9002-61-3 Molekylär formel: C17H28 Molecular weight: 232.40422 EINECS-nummer: 232-660-2