Product name TB500 CAS No. 77591-33-4 Other Names Thymosin beta 4 Molecular Formula C212H350N56O78S Molecular weight 3108.28 Grade Standard Medicine Grade

Nom:Acétate d'ocytocine CAS No: 50-56-6(filet), 6233-83-6(acétate) Formule: C43H66N12O12S2 moléculaire:1007 Séquence: Pureté CYIQNCPLG:98% Apparence: source de poudre blanche: synthétique

Product Name Oxytocin CAS 24346-32-5 Pureté 99% MF C43H65N11O13S2 MW 1008.17

Product Name Oxytocin Synonyms OXYTOCIN; Pitocin; Ocytocin; Syntocinon CAS NO. 50-56-6 Molecular Formula C43H66N12O12S2 Molecular Weight 1007.193 Pureté 99% Aspect Poudre Blanche

Nom: Sermorelin Acetate Cas No: 86168-78-7(filet),114466-38-5(acétate) Formule: C151H250N44O44S Molecular:3417 Séquence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Apparence: source de poudre blanche: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

Nom du produit:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Formule moléculaire: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (CLHP): 98.0%min. Sermorelin Appearance: White powder Specification:2mg/vial Grade:Qualité pharmaceutique

Product Name Hexarelin Acetate Alias Examorelin CAS 208251-52-9 Molecular Formula C49H62N12O8 Molecular Weight 947.11 Pureté 98% Specification 2mg/vial Grade Pharmaceutical Grade Appearance White Powder

Product name Hexarelin CAS No. 140703-51-1 Other Names Hexarelin Acetate Molecular Formula C47H58N12O6 Molecular weight 3108.28 Grade Standard Medicine Grade

Product Name Ipamorelin Synonyms IpoMarelin;Ipamorelin Acetate;Aib-His-D-2-Nal-D-Phe-Lys-NH2;170851-70-4 CAS 170851-70-4 MF C38H49N9O5 MW 711.863 EINECS N/A Product Categories Peptides Appearance White Lyophilized Powder Purity 99%

Nom du produit: Growth hormone releasing peptide GHRP-6 CAS No: 87616-84-0 Formule moléculaire: C46H56N12O6 Molecular Weight: 873.01 Place of Origin: China Type: HGH

Product name GHRP-2 CAS No. 158861-67-7 Other Names Pralmorelin Molecular Formula C45H55N9O6 Molecular weight 817.97 Grade Standard Medicine Grade

Melanotan 2 (MT2)Melanotan-II Melanotan 2CAS 121062-08-6 Melanotan 2Purity (par CLHP): 99.00% Melanotan 2Appearance: White Powder Melanotan 2CAS Number: 121062-08-6 Melanotan 2Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2 Melanotan 2Molecular Formula: C50H69N15O9 Melanotan 2Molecular weight: 1024.2 Storage Condition; away from light, cold storage (2-8 degré) Usage: prevention sunlight-induce skin cancer; Sexual Dysfunction & Fat Decomposition

Apparence : White powder Specific Optical Rotation (c=0.5,10% HAc) :-50.0~-60.0° Water Content(Karl Fischer) : ≤5.0% Acetate Content(par CLHP) : ≤15.0% Amino Acid Composition :±10% of theoretical Purity(par CLHP) : ≥98,0 % d'impureté unique(par CLHP) : ≤1.0% Peptide Content(par %N) : ≥80% Assay(Par anhydre, Sans acide acétique ) : 95.0~105.0% Bacterial Endotoxins : ≤5EU/mg

Name PEG MGF CAS No. N/A Synonyms Pegylated MGF, PEG Assay >98% Description White powder Molecular Formula C121H200N42O39 Molar Mass 2888.16 Usage Muscles grow Storage 2-8 degree centigrade refrigerator Specification 2mg/vial Packaging 10 Vials/Kit

Nom: MGF English synonym: Mechano Growth Factor CAS number: 12020-86-9 Formule moléculaire: FKLiMgO5Si2+ Molecular weight: 225.51 Numéro EINECS: 200-001-8

Nom: Chorionic Gonadotropin English synonym: Peptide HCG CAS number: 9002-61-3 Formule moléculaire: C17H28 Molecular weight: 232.40422 Numéro EINECS: 232-660-2