China Anaboliese Steroïede Poeder Vervaardiger
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнськаудмурт кыл

Steroïede Rou poeier

» Tags » Steroids Raw Powder

TB500 CAS:77591-33-4

TB500 CAS:77591-33-4

Product name TB500 CAS No. 77591-33-4 Other Names Thymosin beta 4 Molecular Formula C212H350N56O78S Molecular weight 3108.28 Grade Standard Medicine Grade

Oxytocin Acetate CAS:6233-83-6

Oxytocin Acetate CAS:6233-83-6

Naam:Oxytocin Acetate Cas No: 50-56-6(net), 6233-83-6(asetaat) Formule: C43H66N12O12S2 Molecular:1007 Volgorde: CYIQNCPLG Purity:98% Voorkoms: white powder Source: sintetiese

Oxytocin CAS:24346-32-5

Oxytocin CAS:24346-32-5

Product Name Oxytocin CAS 24346-32-5 Reinheid 99% MF C43H65N11O13S2 MW 1008.17

Oxytocin CAS:50-56-6

Oxytocin CAS:50-56-6

Product Name Oxytocin Synonyms OXYTOCIN; Pitocin; Ocytocin; Syntocinon CAS NO. 50-56-6 Molecular Formula C43H66N12O12S2 Molecular Weight 1007.193 Reinheid 99% Appearance White Powder

Sermorelin Acetate CAS:114466-38-5

Sermorelin Acetate CAS:114466-38-5

Naam: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(asetaat) Formule: C151H250N44O44S Molecular:3417 Volgorde: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Voorkoms: white powder Source: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

Sermorelin CAS:86168-78-7

Sermorelin CAS:86168-78-7

Produk Naam:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molekulêre Formule: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance: White powder Specification:2mg/vial Grade:Farmaseutiese Graad

Hexarelin Acetate CAS:208251-52-9

Hexarelin Acetate CAS:208251-52-9

Product Name Hexarelin Acetate Alias Examorelin CAS 208251-52-9 Molecular Formula C49H62N12O8 Molecular Weight 947.11 Reinheid 98% Specification 2mg/vial Grade Pharmaceutical Grade Appearance White Powder

Hexarelin CAS:140703-51-1

Hexarelin CAS:140703-51-1

Product name Hexarelin CAS No. 140703-51-1 Other Names Hexarelin Acetate Molecular Formula C47H58N12O6 Molecular weight 3108.28 Grade Standard Medicine Grade

Ipamorelin CAS:170851-70-4

Ipamorelin CAS:170851-70-4

Product Name Ipamorelin Synonyms IpoMarelin;Ipamorelin Acetate;Aib-His-D-2-Nal-D-Phe-Lys-NH2;170851-70-4 CAS 170851-70-4 MF C38H49N9O5 MW 711.863 EINECS N/A Product Categories Peptides Appearance White Lyophilized Powder Purity 99%

GHRP-6 CAS:87616-84-0

GHRP-6 CAS:87616-84-0

Produk Naam: Growth hormone releasing peptide GHRP-6 CAS No: 87616-84-0 Molekulêre Formule: C46H56N12O6 Molecular Weight: 873.01 Plek van oorsprong: China Type: HGH

GHRP-2 CAS:158861-67-7

GHRP-2 CAS:158861-67-7

Product name GHRP-2 CAS No. 158861-67-7 Other Names Pralmorelin Molecular Formula C45H55N9O6 Molecular weight 817.97 Grade Standard Medicine Grade

Melanotan-2 CAS:121062-08-6

Melanotan-2 CAS:121062-08-6

Melanotan 2 (MT2)Melanotan-II Melanotan 2CAS 121062-08-6 Melanotan 2Purity (deur HPLC): 99.00% Melanotan 2Appearance: White Powder Melanotan 2CAS Number: 121062-08-6 Melanotan 2Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2 Melanotan 2Molecular Formula: C50H69N15O9 Melanotan 2Molecular weight: 1024.2 Storage Condition; away from light, cold storage (2-8 graad) Gebruik: prevention sunlight-induce skin cancer; Sexual Dysfunction & Fat Decomposition

CJC-1295 DAC

CJC-1295 DAC

Voorkoms : White powder Specific Optical Rotation (c=0.5,10% HAc) :-50.0~-60.0° Water Content(Karl Fischer) : ≤5.0% Acetate Content(deur HPLC) : ≤15.0% Amino Acid Composition :±10% of theoretical Purity(deur HPLC) : ≥98.0% Single Impurity(deur HPLC) : ≤1.0% Peptide Content(deur %N) : ≥80% Assay(Deur Anhydrous, Asynsuurvry ) : 95.0~105.0% Bacterial Endotoxins : ≤5EU/mg

PEG MGF

PEG MGF

Name PEG MGF CAS No. N/A Synonyms Pegylated MGF, PEG Assay >98% Description White powder Molecular Formula C121H200N42O39 Molar Mass 2888.16 Usage Muscles grow Storage 2-8 degree centigrade refrigerator Specification 2mg/vial Packaging 10 Vials/Kit

MGF CAS:12020-86-9

MGF CAS:12020-86-9

Naam: MGF English synonym: Mechano Growth Factor CAS number: 12020-86-9 Molekulêre formule: FKLiMgO5Si2+ Molecular weight: 225.51 EINECS-nommer: 200-001-8

HCG CAS:9002-61-3

HCG CAS:9002-61-3

Naam: Chorionic Gonadotropin English synonym: Peptide HCG CAS number: 9002-61-3 Molekulêre formule: C17H28 Molecular weight: 232.40422 EINECS-nommer: 232-660-2

  • Ons voordeel

    Goeie prys

    Hoë kwaliteit

    Vinnige aflewering

    Veilige versending

    Uitstekende Na-verkope diens

  • Plaaslike pakhuis

    EU-pakhuis

    Britse pakhuis

    VSA pakhuis

    Kanada pakhuis

    Australië pakhuis

  • Betalings metode

    Paypal

    Bitcoin

    Bank Oorplasing

    Geld Gram

    Westerse Unie

  • Kontak Ons

    E-pos: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Foon: 0086-15636286252

    Webwerf: www.steroid-peptide.com

    Verwelkom jou navraag