China Fabrikant van anabole steroïdenpoeder
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнськаудмурт кыл

Steroïden Ruw Poeder

» Tags » Steroids Raw Powder

TB500 CAS:77591-33-4

TB500 CAS:77591-33-4

Product name TB500 CAS No. 77591-33-4 Other Names Thymosin beta 4 Molecular Formula C212H350N56O78S Molecular weight 3108.28 Graad Standaard medicijngraad

Oxytocin Acetate CAS:6233-83-6

Oxytocin Acetate CAS:6233-83-6

Naam:Oxytocin Acetate Cas No: 50-56-6(net), 6233-83-6(acetaat) Formule: C43H66N12O12S2 Molecular:1007 Reeks: CYIQNCPLG Purity:98% Uiterlijk: wit poeder Bron: synthetisch

Oxytocin CAS:24346-32-5

Oxytocin CAS:24346-32-5

Product Name Oxytocin CAS 24346-32-5 Zuiverheid 99% MF C43H65N11O13S2 MW 1008.17

Oxytocin CAS:50-56-6

Oxytocin CAS:50-56-6

Product Name Oxytocin Synonyms OXYTOCIN; Pitocin; Ocytocin; Syntocinon CAS NO. 50-56-6 Molecular Formula C43H66N12O12S2 Molecular Weight 1007.193 Zuiverheid 99% Uiterlijk Wit poeder

Sermorelin Acetate CAS:114466-38-5

Sermorelin Acetate CAS:114466-38-5

Naam: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetaat) Formule: C151H250N44O44S Molecular:3417 Reeks: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Uiterlijk: wit poeder Bron: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

Sermorelin CAS:86168-78-7

Sermorelin CAS:86168-78-7

productnaam:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermoreline ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Moleculaire formule: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance: White powder Specification:2mg/vial Grade:Farmaceutische kwaliteit:

Hexarelin Acetate CAS:208251-52-9

Hexarelin Acetate CAS:208251-52-9

Product Name Hexarelin Acetate Alias Examorelin CAS 208251-52-9 Molecular Formula C49H62N12O8 Molecular Weight 947.11 Zuiverheid 98% Specification 2mg/vial Grade Pharmaceutical Grade Appearance White Powder

Hexarelin CAS:140703-51-1

Hexarelin CAS:140703-51-1

Product name Hexarelin CAS No. 140703-51-1 Other Names Hexarelin Acetate Molecular Formula C47H58N12O6 Molecular weight 3108.28 Graad Standaard medicijngraad

Ipamorelin CAS:170851-70-4

Ipamorelin CAS:170851-70-4

Product Name Ipamorelin Synonyms IpoMarelin;Ipamorelin Acetate;Aib-His-D-2-Nal-D-Phe-Lys-NH2;170851-70-4 CAS 170851-70-4 MF C38H49N9O5 MW 711.863 EINECS N/A Product Categories Peptides Appearance White Lyophilized Powder Purity 99%

GHRP-6 CAS:87616-84-0

GHRP-6 CAS:87616-84-0

productnaam: Growth hormone releasing peptide GHRP-6 CAS No: 87616-84-0 Moleculaire formule: C46H56N12O6 Molecular Weight: 873.01 Plaats van herkomst: China Type: HGH

GHRP-2 CAS:158861-67-7

GHRP-2 CAS:158861-67-7

Product name GHRP-2 CAS No. 158861-67-7 Other Names Pralmorelin Molecular Formula C45H55N9O6 Molecular weight 817.97 Graad Standaard medicijngraad

Melanotan-2 CAS:121062-08-6

Melanotan-2 CAS:121062-08-6

Melanotaan 2 (MT2)Melanotan-II Melanotan 2CAS 121062-08-6 Melanotan 2Purity (door HPLC): 99.00% Melanotan 2Appearance: White Powder Melanotan 2CAS Number: 121062-08-6 Melanotan 2Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2 Melanotan 2Molecular Formula: C50H69N15O9 Melanotan 2Molecular weight: 1024.2 Storage Condition; away from light, cold storage (2-8 degree) Gebruik: prevention sunlight-induce skin cancer; Sexual Dysfunction & Fat Decomposition

CJC-1295DAC

CJC-1295DAC

Uiterlijk : White powder Specific Optical Rotation (c=0.5,10% HAc) :-50.0~-60.0° Water Content(Karl Fischer) : ≤5.0% Acetate Content(door HPLC) : ≤15.0% Amino Acid Composition :±10% of theoretical Purity(door HPLC) : ≥98.0% Single Impurity(door HPLC) : ≤1.0% Peptide Content(door %N) : ≥80% Assay(door watervrij, Azijnzuurvrij ) : 95.0~105.0% Bacterial Endotoxins : ≤5EU/mg

PEGMGF

PEGMGF

Name PEG MGF CAS No. N/A Synonyms Pegylated MGF, PEG Assay >98% Description White powder Molecular Formula C121H200N42O39 Molar Mass 2888.16 Usage Muscles grow Storage 2-8 degree centigrade refrigerator Specification 2mg/vial Packaging 10 Vials/Kit

MGF CAS:12020-86-9

MGF CAS:12020-86-9

Naam: MGF English synonym: Mechano Growth Factor CAS number: 12020-86-9 Moleculaire formule: FKLiMgO5Si2+ Molecular weight: 225.51 EINECS-nummer: 200-001-8

HCG CAS:9002-61-3

HCG CAS:9002-61-3

Naam: Chorionic Gonadotropin English synonym: Peptide HCG CAS number: 9002-61-3 Moleculaire formule: C17H28 Molecular weight: 232.40422 EINECS-nummer: 232-660-2

  • Ons voordeel:

    Goede prijs

    Van hoge kwaliteit

    Snelle bezorging

    Veilige verzending

    Uitstekende service na verkoop!

  • Lokaal magazijn

    EU-magazijn

    VK magazijn

    VS magazijn

    Canada Magazijn

    Australië Magazijn

  • Betalingswijze

    Paypal

    Bitcoin

    Bankoverschrijving

    Geld Gram

    Western Union

  • Neem contact met ons op

    E-mail: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Telefoon: 0086-15636286252

    Website: www.steroid-peptide.com

    Stem in met uw onderzoek!

  • Onderhoud