İsim: Sermorelin Asetat
CAS Numarası: 86168-78-7(açık),114466-38-5(asetat)
formül: C151H250N44O44S
Moleküler:3417
Sekans: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Saflık:98%
Dış görünüş: Beyaz toz
Kaynak: sentetik
Ayrıca şöyle bilinir: Referans, BAZI-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Sermorelin'in Serono Markası, Sermorelina, Sermorelinum, Referans (TN), Sermoreline [Fransızca].
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GİF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.
Sermorelin Acetate is a truncated analog of a growth hormone releasing factor (GİF 1-44) that is naturally produced by the brain to stimulate pituitary production of human growth hormone. The increased volume of human growth hormone (hGH) produced by the pituitary gland causes an increase in the production of Insulin-Like Growth Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.
The purpose of adult Sermorelin growth hormone therapy is to reverse the effects of aging and secure the extensive treatment benefits described below.
Even though in bodybuilding circles we don't hear much about Sermorelin, this doesn't mean that this peptide does not have its uses. In fact, anti-aging and hormone replacement clinics have been prescribing it for years because it works as a clean GHRH. The problem for the bodybuilder or athlete is that it has a very short half-life of about ten (10) minutes. This becomes an unattractive feature when compared to the half-life of MOD GRF (1-29) (CJC 1295 without DAC), which comes in around 30 minutes. Despite its short window, it does bind quite effectively to the pituitary receptors. The other main down side associated with its very short half life is that it is quickly broken down by blood enzymes within minutes. This is why a GHRH peptide with a half life of 30 minutes or longer is desirable, since it will survive the blood enzyme death and allow it to circulate the body looking for hormone receptors to bind to.