Navn: Sermorelinacetat
Cas No: 86168-78-7(net),114466-38-5(acetat)
Formel: C151H250N44O44S
Molekylær:3417
Sekvens: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Renhet:98%
Utseende: hvitt pulver
Kilde: syntetisk
Også kjent som: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.
Sermorelin Acetate is a truncated analog of a growth hormone releasing factor (GRF 1-44) that is naturally produced by the brain to stimulate pituitary production of human growth hormone. The increased volume of human growth hormone (hGH) produced by the pituitary gland causes an increase in the production of Insulin-Like Growth Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.
The purpose of adult Sermorelin growth hormone therapy is to reverse the effects of aging and secure the extensive treatment benefits described below.
Even though in bodybuilding circles we don't hear much about Sermorelin, this doesn't mean that this peptide does not have its uses. Faktisk, anti-aging and hormone replacement clinics have been prescribing it for years because it works as a clean GHRH. The problem for the bodybuilder or athlete is that it has a very short half-life of about ten (10) minutter. Dette blir et lite attraktivt trekk sammenlignet med halveringstiden til MOD GRF (1-29) (CJC 1295 uten DAC), som kommer inn rundt 30 minutter. Til tross for det korte vinduet, det binder seg ganske effektivt til hypofysereseptorene. Den andre viktigste ulempen forbundet med dens svært korte halveringstid er at den raskt brytes ned av blodenzymer i løpet av minutter. Dette er grunnen til et GHRH-peptid med en halveringstid på 30 minutter eller lenger er ønskelig, siden det vil overleve blodenzymets død og tillate det å sirkulere kroppen på jakt etter hormonreseptorer å binde seg til.
