Ime: Sermorelin acetat
Cas Št: 86168-78-7(net),114466-38-5(acetat)
Formula: C151H250N44O44S
Molekularno:3417
Zaporedje: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Čistost:98%
Videz: beli prah
Vir: sintetični
Poznan tudi kot: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelin, Geref (TN), Sermoreline [French].
Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.
Sermorelin Acetate is a truncated analog of a growth hormone releasing factor (GRF 1-44) that is naturally produced by the brain to stimulate pituitary production of human growth hormone. The increased volume of human growth hormone (hGH) produced by the pituitary gland causes an increase in the production of Insulin-Like Growth Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.
The purpose of adult Sermorelin growth hormone therapy is to reverse the effects of aging and secure the extensive treatment benefits described below.
Even though in bodybuilding circles we don't hear much about Sermorelin, this doesn't mean that this peptide does not have its uses. Pravzaprav, anti-aging and hormone replacement clinics have been prescribing it for years because it works as a clean GHRH. The problem for the bodybuilder or athlete is that it has a very short half-life of about ten (10) minut. To postane neprivlačna lastnost v primerjavi z razpolovno dobo MOD GRF (1-29) (CJC 1295 brez DAC), ki pride naokrog 30 minut. Kljub kratkemu oknu, precej učinkovito se veže na receptorje hipofize. Druga glavna pomanjkljivost, povezana z njegovo zelo kratko razpolovno dobo, je, da jo krvni encimi hitro razgradijo v nekaj minutah. Zato je peptid GHRH z razpolovno dobo 30 minut ali dlje je zaželeno, ker bo preživel smrt krvnega encima in mu omogočil kroženje po telesu, išče hormonske receptorje, na katere bi se lahko vezal.