China Anabolic Steroids Powder Manufacturer
EnglishAfrikaansБългарскиNederlandsFrançaisDeutschItaliano日本語LatīnaNorskپارسیPolskiPortuguêsRomânăРусскийSlovenčinaSlovenščinaEspañolSvenskaTürkçeУкраїнськаудмурт кыл

Pharmaceutical Peptides

» Peptides » Pharmaceutical Peptides

  • Specifications
  • Product Description
  • Product Usage

Product Name: FOXO4-DRI
Trade Name:Proxofim
Molecular Formula: C228H388N86O64
Molecular Weight: 5358.05 g/mol
Specifition: 1mg/Vials
Purity : 98% HPLC
Appearance:  White Lyophilized Powder
Typical use:Anti-aging Weight loss
Standard Packing : 10vials/kits
Shelf Life:6 Month
Storage:Room temperature away from light

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4-DRI is a synthetic version of FOXO4, which contains D amino acids instead of L amino acids. This modification allows it to retain the functionality of the original protein and longer shelf life, and lower clearance from the body. Its most prominent function is the regulation of apoptosis in senescent cells. It inhibits FOXO4-p53 binding. Thus p53 can target pro-apoptotic genes and promote their expression. These proteins, in turn, bring about apoptosis of old cells, thereby reducing the old cell burden in tissues. This increases cellular differentiation and tissue repair,
and regrowth and decrease in “biological age.”

FOXO4 is known to help the perpetuation of aged or senescent cells.It binds to p53 and thereby prevents apoptotic death of the senescent cells. The DRI peptide prevents FOXO4-p53 interaction.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice

Enquiry Form ( we will get back you as soon as possible )

Name:
*
Email:
*
Message:

Verification:
3 + 7 = ?

Maybe you like also

  • Our Advantage

    Good Price

    High Quality

    Fast Delivery

    Safe Shipment

    Excellent After-sale Service

  • Local Warehouse

    EU Warehouse

    UK Warehouse

    USA Warehouse

    Canada Warehouse

    Australia Warehouse

  • Payment Method

    Paypal

    Bitcoin

    Bank Wire

    Money Gram

    Western Union

  • Contact Us

    Email: jacob@steroid-peptide.com

    WhatsApp: +8615636286252

    Phone: 0086-15636286252

    Website: www.steroid-peptide.com

    Welcome your inquiry